General Information

  • ID:  hor007208
  • Uniprot ID:  Q86YW7
  • Protein name:  Glycoprotein hormone beta-5
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Human
  • Expression:  Highly expressed in brain and at low levels in pituitary. Also found in retina; testis and skin but not in pancreas; parotid; kidney; stomach; liver; colon; small intestine; thyroid; brain or adrenal
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0005179 hormone activity; GO:0046982 protein heterodimerization activity; GO:0031531 thyrotropin-releasing hormone receptor binding
  • GO CC:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0002155 regulation of thyroid hormone mediated signaling pathway; GO:0031531; F:thyrotropin-releasing hormone receptor binding; IMP:UniProtKB.; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway

Sequence Information

  • Sequence:  ASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI
  • Length:  106
  • Propeptide:  MKLAFLFLGPMALLLLAGYGCVLGASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI
  • Signal peptide:  MKLAFLFLGPMALLLLAGYGCVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA